PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010934130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 337aa    MW: 37328.5 Da    PI: 6.26
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010934130.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.6e-143883146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde+l+++v+++G+++W++I ++  + Rt+k+c++rw +
   XP_010934130.1 38 KGPWMAEEDEILIEYVRKHGPRDWSSIRSKGLLPRTGKSCRLRWVN 83
                     79*************************8876677**********87 PP

2Myb_DNA-binding46.87e-1594134345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++++eE+ + +d+ +q+G++ W++Ia +++ gRt++++k++w 
   XP_010934130.1  94 KFSPEEERIVIDLQAQFGNK-WARIATYLP-GRTDNDVKNFWS 134
                      79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6673385IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-203686IPR009057Homeodomain-like
SuperFamilySSF466893.88E-2836133IPR009057Homeodomain-like
SMARTSM007171.5E-123787IPR001005SANT/Myb domain
PfamPF002499.3E-133883IPR001005SANT/Myb domain
CDDcd001674.52E-134085No hitNo description
PROSITE profilePS5129421.0286141IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-1987139IPR009057Homeodomain-like
SMARTSM007175.3E-1391139IPR001005SANT/Myb domain
CDDcd001671.66E-1194133No hitNo description
PfamPF002495.9E-1394134IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MQGSGGGSQC TATSSNHISS GGKTNGRAEG GGGMVMRKGP WMAEEDEILI EYVRKHGPRD  60
WSSIRSKGLL PRTGKSCRLR WVNKLKPDLK TGCKFSPEEE RIVIDLQAQF GNKWARIATY  120
LPGRTDNDVK NFWSTRQKRL ARILRTPLPS RSSKNHGKVP ISSHEVAHLE GPSLDLILLE  180
GDSSNGQCSQ AASKMAQMPD IMNPVPLNLD TALPLLEPAM EKEPRLSNNP LPPLLLSFDR  240
LPHPLIDLPL LQEDASELLP SYRDVSFPDE FACLEPCPCM PPPQGLPFFG LDAEQNGITK  300
VDKYPRTPDF FEDLPSDMFD YLEQPPPPPP PPSSTSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-273613925126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934130.10.0PREDICTED: myb-related protein MYBAS2-like
TrEMBLK9LXH96e-95K9LXH9_9ASPA; R2R3 MYB DUO1-like protein
STRINGSi012032m1e-92(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.13e-63MYB family protein